EVA results for 1k8k:G

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3
seq	ARFRKVDVDEYDENKFVDEDDGAGPDEGEV
dssp	-HHH---HHHH---------------HHHH
apssp	----EE-------------------HHHHH	-1.3	+4.5	-0.09
jpred	--------------------------HHHH	+2.9	-11.5	-0.02
phd	---EEE---------------------HHH	-4.3	-1.5	-0.09
phdpsi	---EEE---------------------HHH	-7.1	-3.7	-0.13
profsec	---EEE--------------------HHHH	-6.2	-6.7	-0.13
samt99_sec	-H-EEE-------------HHH----HHHHHHHHHH--HHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH--------HHHHHHHHHHHHHHH---EEEEEE-----	+3.4	+4.9	-0.06
sspro2	---EEEE------H------------HHHH	-12.9	-21.1	-0.29

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)