EVA results for 1k7b:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	SCPPGQFRCSEPPGAHGECYPQDWLCDGHPDCDDGRDEWGCG
dssp	-----EE------------EEHHH--------------HHH-
apssp	------------------------------------------	+5.2	-32.8	-0.31
phd	------EEE-------EEE----EE-----------------	-6.3	+5.0	-0.25
phdpsi	-----EEE---------EEE----------------------	+2.1	+9.9	-0.08
prof_king	-----EEEE--------EEEEEEEE-----------------	-0.5	+9.5	-0.08
profsec	------EEE---------EE---EE-----------------	-4.9	+6.8	-0.30
sspro2	------EE----------------------------------	-0.2	-22.3	-0.28
jpred	------EEE---------------------------------	0.0	-20.2	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)