EVA results for 1k5j:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	SLIWGCELNEQNKTFEFKEHQLALRTVCLGDKA
dssp	-EEEEEEE-----EEEE----EEEEEEEE----
apssp	--EEEE-E-------EEHHHHHHHHHHH-----	-15.7	-10.8	-0.03
jpred	--EE--E--------E-HHHHHHHHHHHH----	-31.3	-33.9	-0.20
phd	--EEEEEE------EEEE--EEEEEEEEE----	+16.9	+28.6	+0.2
phdpsi	--EEEEEE-----EEEEEEEEEEEEEEEE----	+10.9	+3.6	+0.1
prof_king	-EEEEEEE-----EEEEEEEEEEEEEEEE----	+13.5	+5.0	+0.22
profsec	--EEEEEE-----EEEEEEEEEEEEEEEE----	+8.5	+0.4	+0.04
psipred	-EEEEEEE-----EEEEEEEEEEEEEEEE----	+11.7	+2.1	+0.17
sspro2	-EEEEEEE-----EEEE--EEEEEEEEEE----	+17.4	+25.8	+0.32

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)