EVA results for 1k5j:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	SLIWGCELNEQNKTFEFKEHQLALRTVCLGDKA
dssp	-EEEEEEE-----EEEE---EEEEEEEEE----
apssp	--EEEE-E------HHEHHHHHHHHHHH-----	-18.7	-15.8	0.00
jpred	--EE-EE-------EEEHHHHHHHHHHHH----	-22.2	-19.8	-0.07
phd	--EEEEEE------EEEE--EEEEEEEEE----	+19.9	+31.6	+0.29
phdpsi	--EEEEEE-----EEEEE--EEEEEEEEE----	+20.0	+29.4	+0.36
prof_king	-EEEEEEE-----EEEEEEEEEEEEEEEE----	+16.5	+9.0	+0.29
profsec	--EEEEEE-----EEEEEEEEEEEEEEEE----	+11.6	+4.4	+0.10
psipred	-EEEEEEE-----EEEEEEEEEEEEEEEE----	+14.7	+6.1	+0.24
sspro2	-EEEEEEE-----EEEE-EEEEEEEEEE-----	+14.4	+22.7	+0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)