EVA results for 1jzb:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,.
seq	KEGYLVNKSTGCKYGCLKLGENEGCDKECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCS
dssp	--EE-E------E------E--HHHHHHHH-------EEEE----EEEE----------E--E---
apssp	---EEEE-----EEEEE---------HHHH-------EEEEE--EEEEE-----------------	+0.9	-0.5	-0.02
jpred	----EE------EEEEEE--------HHH-----------EE---EEE------------------	-6.2	-10.4	-0.15
phd	--EEEE------EEEEEE------HHHHHHHH------EEEEEEEEE-------------------	+0.1	-5.9	+0.01
phdpsi	---EEE-----EEEEEE-------HHHHHH---------EEE--EEEE------------------	-0.3	-0.0	+0.01
profsec	--EEEE-----EEEEEE--------HHHHH---------EEE--EEEE------------------	-2.5	-4.0	-0.05
psipred	----EEE-----EEEEEE--------HHHHH-------EEE----EEEE------EEEE-------	-10.6	-4.8	-0.19
sspro2	---EEEE-----EEEEEE--------HHHHHH-------EEEEEEEEE------------------	-13.9	-19.4	-0.23

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)