EVA results for 1jvp:P

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR
dssp	---EEEEEEEEE---EEEEEEEE-----EEEEEEE-
apssp	------------------EEEE------EEEEEEE-	-9.0	-10.2	-0.09
phd	--HHHHHHHH---EEEEEEEHHH-----EEEEEE--	-14.4	-1.5	-0.00
phdpsi	-----HHHHH------EEEEEEE-----EEEEEE--	-4.9	-0.4	+0.1
prof_king	--H-----------EEEEEEE------EEEEEEE--	-16.4	-4.8	-0.22
profsec	----HHHHH------EEEEEEEE-----EEEEEEE-	-1.7	-0.6	+0.12
sspro2	----EEE-E-----EEEEEEEE------EEEEEEE-	+3.4	-5.0	-0.06

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)