EVA results for 1jrj:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....
seq	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
dssp	------HHHHHHHHHHHHHHHHHHHHH--HHH-------
apssp	----------HHHHHHHHHHHHHHHH-------------	+12.1	+23.2	+0.18
jpred	---------HHHHHHHHHHHHHHHHHH------------	+10.8	+16.7	+0.17
phd	-----E---HHHHHHHHHHHHHHHHHHH-----------	+8.5	+19.5	+0.10
phdpsi	---------HHHHHHHHHHHHHHHHHHH-----------	+8.2	+17.4	+0.07
prof_king	---------HHHHHHHHHHHHHHHHHHH----H------	+5.3	+20.1	-0.04
profsec	-----------HHHHHHHHHHHHHHHH------------	+3.2	+10.5	+0.07
psipred	----EEEHHHHHHHHHHHHHHHHHHHH------------	+8.5	+13.5	+0.16
samt99_sec	---------HHHHHHHHHHHHHHHHHHH-----------	+6.5	+15.6	+0.02
sspro2	--------HHHHHHHHHHHHHHHHHHH------------	+11.0	+14.7	+0.16

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)