EVA results for 1jo6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,
seq	MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED
dssp	---------------------HHHHHHHH----------------
apssp	-E-E------------HHHHHHHHHH--------EEEE-E-----	-0.6	-24.8	-0.07
jpred	-EEEE------------HHHHHHH-----------EEEEE-----	-13.7	-21.9	-0.22
phd	-EEEE-------------EEHHHH-----------EEEEEE----	-11	-19.5	-0.05
phdpsi	-EEEE---------HHHHHHHHHHHH--------HHHHHEE----	-20.5	-29.5	-0.23
prof_king	EEEEE-----------HHHHHHHHH----------EEEEEE----	-18.5	-10.4	-0.19
profsec	-EEEE----------HHHHHHHHHHH--HHH----EEEEEE----	-20.6	-33.5	-0.18
psipred	-EEE----------HHHHHHHHHHHHHHHH------EEEE-----	-9.3	-25.6	-0.03
samt99_sec	-EEE------------HHHHHHHHH--HHHH----HHHHHHH---	-17.7	-29.5	-0.27
sspro2	-EEEE-----------HHHHHHHHH----HH-HHHHHHHH-----	-27.2	-34.2	-0.36

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)