EVA results for 1jmx:G

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,..
seq	AVAGCTATTDPGWEVDAFGGVSSLCQPMEADLYGCSDPCWXPAQVPDMMSTYQDWNAQASNSAEDWRNLGTVFPKDK
dssp	---------------------------HHHHHHHHH-------------------------HHHHHHH---------
apssp	----E--------EE---------------------------------------HHHH---HH-HHH----E-----	+1.2	-28.0	-0.26
phd	----EE------EEEEE----EEEE--------------------HHHHHHHHHHHHHH---HHHHHHH--------	-16.5	-35.4	-0.19
phdpsi	-------------EEE-----------------------------HHHHH-----HHHH--HHHHHHHHHH------	-5.7	-25.4	-0.26
prof_king	-------------EEE------HH---HH-----------------------HHH-------HHHHHH---------	+3.9	-18.7	-0.17
profsec	----EE------EEEE-----------------------------HHHHHH-----------HHHHHHHHH------	-9.5	-29.3	-0.30
psipred	--------------------HHHHHHHHHH---------------HHHHHHHHH--------HHHHHHH--------	-7.9	-4.1	-0.34
sspro2	-------------EEE-------------H-----------------HHHHHHHHHHHH---HHHHHH---------	-8.9	-18.8	-0.34

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)