EVA results for 1jmq:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	FEIPDDVPLPAGWEMAKTSSGQRYFKNHIDQTTTWQDPRKAMLSQM
dssp	------------E--E-------EEEE----EEE------------
apssp	----------------------EEEEE----------HHHHHHH--	-1.2	-21.8	-0.12
phd	--------------E-------HHHHH----------HHHHHHH--	-9.1	-16.6	-0.21
phdpsi	-------------EEE-----EEEEEE-------------------	+8.2	+8.5	-0.14
prof_king	--------------EEE-----EEEEEE-----EE-----------	+7.8	+17.6	-0.13
profsec	-------------EEEE-----EEEEE------EE-----------	+5.8	+15.7	-0.16
samt99_sec	-------------EEEE-----EEEEE------------HHHHH--	-4.2	-11.7	-0.20
sspro2	-------------EEEE----EEEEEE------------HHHHH--	-7.5	-14.9	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)