EVA results for 1jkz:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC
dssp	-EEEEE----------HHHHHHHHHHH-----EEEE--EEEEEEE-
apssp	---E---------EE-----------------------EEEE----	-26.4	-34.1	-0.24
jpred	--------------------------------------EEEE----	-24.4	-44.8	-0.12
phd	--EE-------EEEEE-----------EEEEE------EEEEE---	-34.7	-25.0	-0.08
phdpsi	---E----------------HHHHH---------E----EEEE---	-9.3	-3.6	+0.05
prof_king	--EE-----EEEEE---------E------------EEEEEEE---	-34	-35.7	-0.29
profsec	--------------------HHHHH--------------EEEE---	-16.0	-21.0	-0.03
psipred	--HHHHHHH-----------HHH---HHHHH------EEEEEE---	-33.2	-31.5	-0.30
samt99_sec	-------------------HHHHHH---------EEEEEEEEE---	-10.8	-10.8	-0.03
sspro2	--HHHHHH------E-----------H-HHE-------EEEE----	-38.6	-39.6	-0.32

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)