EVA results for 1jkr:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
dssp	--------HHHHHHHHHHH----HHHHHHH----HHHHHHH-----
apssp	--------HHHHHHHHHHH----HHHHHHH-E--HHHHHHH-----	+22.9	+22.2	+0.58
jpred	-------HHHHHHHHHHHH------EEEEEE---HHHHHHH-----	+5.9	+15.0	+0.14
phd	-------HHHHHHHHHHHHH-----EEEEEE---HHHHH-------	+4.3	+17.7	+0.07
phdpsi	-------HHHHHHHHHHHH----HHHHHHEE---HHHEEE------	+10.2	+23.3	+0.24
profsec	-------HHHHHHHHHHHH----HHHHHHEE-----EEEEE-----	+1.5	+10.4	+0.11
psipred	-------HHHHHHHHHHHH----HHHHHHHH---HHHHHEE-----	+13.9	+26.1	+0.31
sspro2	-------HHHHHHHHHHHH----HHHHEHHH-HHHHHHHH------	+9.4	+10.9	+0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)