EVA results for 1jkq:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	RPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
dssp	------HHHHHHHHHHHHH-----HHHHH----HHHHHHH------
apssp	------HHHHHHHHHHHH----HHHHHHH-E--HHHHHHH------	+16.4	+20.5	+0.25
jpred	------HHHHHHHHHHHH--------EEEE-----EEEEE------	-4.8	+1.3	+0.07
phd	------HHHHHHHHHHHHH-----EEEEEE---HHH----------	+8.7	+15.7	+0.23
phdpsi	------HHHHHHHHHHHH----HHHHEEEE---HHHHHE-------	+5.8	+23.3	+0.10
profsec	------HHHHHHHHHHHH----HHHHEEEE---HHHHEEE------	+1.5	+18.5	+0.11
psipred	------HHHHHHHHHHHH----HHHEEEEEE--HHHHHH-------	+0.9	+14.4	-0.00
sspro2	--HH--HHHHHHHHHHHH----HHHHHHHH-HHHHHHH--------	+0.7	+5.1	-0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)