EVA results for 1jko:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
dssp	---------HHHHHHHHHH----HHHHHH-----HHHHHHH-----
apssp	--------HHHHHHHHHHH----HHHHHHH-E--HHHHHHH-----	+18.6	+18.4	+0.37
jpred	-------HHHHHHHHHHHH------EEEEEE---HHHHHHH-----	+3.8	+15.0	+0.05
phd	-------HHHHHHHHHHHHH-----EEEEEE---HHHHH-------	+2.1	+17.7	0.00
phdpsi	-------HHHHHHHHHHHH----HHHHHHEE---HHHEEE------	+8.0	+21.1	+0.15
profsec	-------HHHHHHHHHHHH----HHHHHHEE-----EEEEE-----	-0.6	+8.8	+0.02
psipred	-------HHHHHHHHHHHH----HHHHHHHH---HHHHHEE-----	+9.6	+23.9	+0.2
sspro2	-------HHHHHHHHHHHH----HHHHEHHH-HHHHHHHH------	+5.0	+10.4	0.00

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)