EVA results for 1jj8:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....
seq	GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKK
dssp	-------HHHHHHHHHHH-----HHHHHHHH---HHHHHHH--HHH---
apssp	--------HHHHHHHHHHH----HHHHHHH-E--HHHHHHH--------	+10.8	+18.5	+0.11
jpred	-------HHHHHHHHHHHH------EEEEEE---HHHHHHH--------	+1.0	+0.7	+0.08
phd	-------HHHHHHHHHHHHH-----EEEEEE---HHHH-----------	-2.2	+0.1	+0.03
phdpsi	-------HHHHHHHHHHHH----HHHHHHEE---HHHHHH---------	+11.1	+17.6	+0.17
profsec	-------HHHHHHHHHHHH----HHHHHEEE------EEEE--------	-5.3	-2.9	+0.02
psipred	-------HHHHHHHHHHHH----HHHHHHHH---HHHHHHH--------	+14.4	+14.4	+0.20
sspro2	-------HHHHHHHHHHHH----HHHHEHHH-HHHHHHHH---HHH---	+12.2	+12.7	+0.16

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)