EVA results for 1jj6:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,..
seq	GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
dssp	-------HHHHHHHHHHHH----HHHHHHHH---HHHHHHH--HHH-
apssp	--------HHHHHHHHHHH----HHHHHHH-E--HHHHHHH------	+12.3	+19.9	+0.21
jpred	-------HHHHHHHHHHHH------EEEEEE---HHHHHHH------	+2.1	+2.9	+0.16
phd	-------HHHHHHHHHHHHH-----EEEEEE---HHH----------	-3.5	-1.6	+0.04
phdpsi	-------HHHHHHHHHHHH----HHHHHHEE---HHHH-E-------	+8.4	+17.0	+0.20
profsec	-------HHHHHHHHHHHH----HHHHHHEE---HHHEEEE------	+4.1	+10.4	+0.23
psipred	-------HHHHHHHHHHHH----HHHHHHHH---HHHHHHH------	+16.2	+15.8	+0.31
sspro2	-------HHHHHHHHHHHH----HHHHEHHH-HHHHHHH--------	+5.4	+1.4	-0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)