EVA results for 1jei:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5...
seq	DNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSS
dssp	-------HHHHHHHH------------HHHHHHHHHHHH--------------
apssp	--EHH--HH-HHHHEHH-------------HHHHHHHHEEEHHH---------	+3.8	+23.5	-0.02
jpred	----HHHHHHHHHHHHHH----------HHHHHHHHHHHHHHH----------	+5	+27.2	+0.01
phd	-------HHHHHHHHHHH-------E---HHHHHHHHHHHHHHHHHH------	+2.2	+2.7	-0.01
phdpsi	-------HHHHHHHHHHH-------E---HHHHHHHHHHHHHHHHH-------	+1.5	+3.5	-0.02
prof_king	-------HHHHHHHHHH------------HHHHHHHHHHHHH-----------	+12.4	+30.9	+0.11
profsec	-------HHHHHHHHHHH-----------HHHHHHHHHHHHHHHHH-------	+1.0	+16.6	-0.07
psipred	--HHH--HHHHHHHHHH------------HHHHHHHHHHHHHHHHH-------	-2.5	+5.1	-0.13
pssp	--------HHHHHHHHEE----------HHHHHHHHHHHHHH-------HH--	+18.1	+20.2	+0.20
samt99_sec	--HHHH-HHHHHHHHHHH----------HHHHHHHHHHHHHHH----------	+1.5	+12.7	-0.01
sspro2	--------HHHHHHHHHH----------HHHHHHHHEEEEHHH----------	+0.8	+30.3	-0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)