EVA results for 1jb0:M

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3.
seq	MALTDTQVYVALVIALLPAVLAFRLSTELYK
dssp	----HHHHHHHHHHHHHHHHHHHHHHHHH--
apssp	------------E------HHH---------	-37.3	-34.8	-0.16
phd	---HHHHHHHHHHHHHHHHHHHHHHHHHH--	+25.2	+32.7	+0.50
phdpsi	---HHHHHHHHHHHHHHHHHHHHHHHHHH--	+22.6	+31.1	+0.47
profsec	----HHHHHHHHHHHHHHHHHHHHHHHHH--	+23.4	+27.7	+0.65
psipred	-----HHHHHHHHHHHHHHHHHHHH------	+7.7	+25.1	+0.08
pssp	-------HHHHHHHHHH-HHHHH-HH-HH--	+17.3	-26.0	+0.22
samt99_sec	----HHHHHHHHHHHHHHHHHHHHHHHHH--	+23.9	+29.1	+0.67
sspro2	----HHHHHHHHHHHHHHHHHHHHHHHHH--	+22.8	+29.8	+0.66
prof_king	-----HHHHHHHHHHHHHHHHHHHHHHHHH-	+19.2	+27.7	+0.21

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)