EVA results for 1j8f:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,
seq	GEADMDFLRNLFRLLDELTLEGVARYMQSERCRRVICLVGAGIST
dssp	-HHHHHHHHHH--------HHHHHHHHH------EEEEE-HHH-H
apssp	----HHHHHHHHHHH---HHHHHHHHH------EEEEE----HHE	-0.7	+16.6	0
jpred	----HHHHHHHHHH----HHHHHHHHHHHH---EEEEEE---EE-	-7.4	+5.9	-0.05
phd	---HHHHHHHHHHHH----HHHHHHHHHHH---EEEEEE------	0.0	+8.4	+0.11
phdpsi	--HHHHHHHHH------HHHHHHHHHHHHH---EEEEEE------	+3.8	+12.7	+0.14
prof_king	----H-HHHHHH------HHHHHHHHHHH----EEEEEE------	-1.1	-2.2	+0.08
psipred	----HHHHHHHHHH--HHHHHHHHHHHHHH----EEEEE------	-9.5	-0.7	+0.02
sspro2	----HHHHHHHHHH-----HHHHHHHHHH----EEEEEE---EE-	-5.5	+10.3	-0.04

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)