EVA results for 1j8e:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....
seq	GSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQ
dssp	--------EEE-----EEEHHH-----------HHH-HHHH---
apssp	---------------------EE---------------------	-9.5	-31.2	-0.26
jpred	----------E---------------------------------	-7.8	-32.9	-0.08
phd	---E----EEE----EE---EE----------------------	-2.4	-12.5	-0.08
phdpsi	--------EEE-----EE---------------------E----	+0.9	-0.3	+0.16
prof_king	---------EE---------EEE---------------------	-8.4	-17.4	-0.23
profsec	---------EE-----EE---EE---------------------	-5.8	-11.0	-0.10
sspro2	----------E----------EEE--------------------	-15.1	-26.1	-0.37

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)