EVA results for 1j75:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,..
seq	NLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIG
dssp	-HHHHHHHHHHHH---EEHHHHHHHH---HHHHHHHHHHHHH---EEEEE--EEEE-
apssp	----EEEEEE------EEE-EE---E-----HHHHHHHHHH------------E---	-21.4	-19.0	-0.02
jpred	--HHHHHH---------EEEEEEE------HHHHHHHHHH-----------------	-21.4	-20.3	-0.04
phd	---HHHHHHHH-----EEHHHHHHHH----HHHHHHHHHHHH----------EEE--	+9.3	+15.3	+0.31
phdpsi	-HHHHHHHHHHH----EEHHHHHHH---HHHHHHHHHHHH-------------EEE-	+6.7	+14.7	+0.25
prof_king	-HHHHHHHHH-------EEHHHHHH-----HHHHHHHHHHH----------------	-3.9	+2.4	+0.13
profsec	-HHHHHHHHHH-----EEHHHHHHH----HHHHHHHHHHHHH-----------EE--	+6.0	+9.2	+0.28
psipred	-HHHHHHHHHH-------HHHHHHHH---HHHHHHHHHHHHHHH-------------	-2.4	-2.1	+0.19
pssp	-HHHHEEEEEE------EEE-----------HHHHHHHHHH-----------EEE--	-8.6	-4.5	+0.08
samt99_sec	-HHHHHHHHHHH----HHHHHHHHHH---HHHHHHHHHHHHHH----------EEE-	+6.4	+10.4	+0.20
sspro2	-HHHHHHHHH------EEE-HEEEE----HHHHHHHHHHH-H----------EEE--	-6.7	-10.7	+0.03

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)