EVA results for 1j5e:R

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7...
seq	PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTEKLVRK
dssp	-------------EE------HHHHHHHE-----E--HHHH---HHHHHHHHHHHHHHHH---------EE--
apssp	----------------E----HHHHHHHHH---EE---E----HHHHHHHHHHHHHHHHHHH--HHH-HHH--	-1.5	-6.0	-0.13
apssp2	---------------EE----HHHHHHH-----EEEE-------HHHHHHHHHHHHHHHHH-----HHHH---	-7.2	+0.6	-0.18
phd	---------------------HHHHHHHHHH---EEE-------HHHHHHHHHHHHHHHHHEE----------	+7.8	+3.3	+0.1
phdpsi	---------------------HHHHHHHHHH---EEEE------HHHHHHHHHHHHHHHHHHE----------	+3.6	-0.1	+0.01
profsec	---------------------HHHHHHHHHH---EE--------HHHHHHHHHHHHHHHHHH-----HHH---	+1.4	-0.5	-0.06
psipred	--------------EEE----HHHHHHH-----EEEE------HHHHHHHHHHHHHHHHHH-----HHHH---	-2.2	+5.8	-0.08
sspro2	---------------EE--H-HHHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHHHHHHH--	-11.4	-18.7	-0.22

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)