EVA results for 1j5e:N

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6
seq	ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
dssp	--HHH--HHH-----HHH----------HHHE------EHHHHHHHHHH------EE---
apssp	-HHHHHHHHH-------------EE------------HHHHHHHHHHHH-----------	-2.2	-20.9	-0.13
apssp2	--HHHHHHHHH----HHHE---EEE-----EEE------HHHHHHHHH-------E----	-5.8	-11.4	-0.17
phd	---HHHHHHH---------------------E-------HHHHHHHHH------------	+8.0	-6.1	+0.06
phdpsi	--HHHHHHHHH------------E---------------HHHHHHHHH------------	+0.5	-19.0	-0.04
profsec	--HHHHHHHH------------EEE------EEEE----HHHHHHHHH------------	-6.6	-19.9	-0.07
psipred	--HHHHHHHHH---HHHH----EEE-----EEE------HHHHHHHHH-------EE---	+0.7	-4.1	-0.04
sspro2	-HHHHHHHH-------EEE----E-----HHHHHHH-HHHHHHHHHHH------EEE---	-8.9	-11.2	-0.19

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)