EVA results for 1izl:E

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,
seq	RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGL
dssp	-------------------HHHH------HHHH--
apssp2	--HHHHHH----EEEEEE-HHHHEHHHHHE-----	-37.8	-49.7	-0.34
phd	------EEEEEEEEEEEEE--EEEEEEEEEEE--E	-50.8	-37.2	-0.29
phdpsi	------EEEEEEEEEEEEE--EEEEEEEEEEE--E	-52.9	-39.1	-0.31
prof_king	-----EEEEEEEEEEEEEE--HEEEEEEEEEE---	-50.1	-40.0	-0.23
profsec	-----EEEEEEEEEEEEEEHHHHHH----EEE--E	-35.1	-19.6	-0.21
prospect	--HHHHHHHHH-EEEEEEE-HHHHH--EEEEE---	-43.5	-45.8	-0.30
psipred	--HHHHHHH--EEEEEEEE-HHHHHHHHHHH----	-44.2	-53.1	-0.27
samt99_sec	--HHHHHHHHHEEEEEEEEHHHHHHHHHHEEH---	-49.1	-45.7	-0.34
sspro2	--HHHHHHHHHHHHHHH-HHHHHHHHHHHHHH---	-40.0	-52.2	-0.33

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)