EVA results for 1iwc:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....
seq	MGKAENYELYQVELGPGPSGDMAAKMSKKKAGRG
dssp	----HHHHHHHHHH---------HHHHHH-----
apssp	-------E-EEEE-------HHHHHHHHHH----	-36.6	-35.1	-0.31
apssp2	------EEEEEEEE------HHHHHHHHH-----	-12.7	+0.4	+0.06
phd	------EEEEEE-------HHHHHHHHHHH----	-13.7	-5.6	-0.04
phdpsi	------EEEEEE-------HHHHHHHHHHH----	-16.4	-7.9	-0.08
prof_king	------EEEEEEE---------EEEEE-------	-23.0	-16.3	+0.04
profsec	----EEEEEEEEE------HHHHHHHHHHHH---	-22.0	-13.8	+0.04
prospect	-------EEEEEE--------HHHHHHH------	-9.8	+0.9	-0.02
psipred	------EEEEEEEE------HHHHHHHHH-----	-13.7	-1.9	+0.04
samt99_sec	-------EEEEEEE-------HHHHHHHH-----	-9.9	-0.3	+0.04
sspro2	------EEEEEEE--------HHHHH-HHH----	-15.3	-8.4	-0.04

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)