EVA results for 1iw4:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE
dssp	-E-------------------EEEE-----EEE--HHHHHHH-----EE------
apssp	--------------------EEEEEE----HH----E--E---------------	-3.9	-7.4	-0.17
apssp2	---------HHHHHHHHHHHHHHHHH--HHHHHHHHHHHH---------------	-35.8	-37.1	-0.49
prof_king	--------------------EEEEEE---HHH----EEEEEE-------------	-3.6	-6.0	-0.01
prospect_secstruc	-------------HHHHHHHHHHHH--------HHHHHHHHHHH-----------	-11.7	-7.8	-0.15
psipred	---------HHHHHHHHHHHHHHHHH--HHHHHHHHHHHH---------------	-30.5	-32.7	-0.37
samt99_sec	---------------HHH--HEEEEH--HHHHHHHHHHHH-------E-------	-4.6	-11.1	-0.07
sspro2	----------HHHHHHHHHHHHHHHH---HHHHHHHHHH-------EEE------	-25.9	-14.8	-0.26
prospect	-------------HHHHHHHHHHHH--------HHHHHHHHHHH-----------	-11.7	-7.4	-0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)