EVA results for 1irq:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....
seq	DIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
dssp	----EEEEEEEHHHHHHHHHHHHH----HHHHHHHHHHHHHHHH-HHH-
apssp	-------EEHHHHHHEEEEEEE-------EEHHHHHHHHHHHHH-----	-8.8	+5.4	+0.01
jpred	-------EEEE----EEEEEE-------HHHHHHHHHHHHHHHH-----	-12.6	-9.1	-0.03
phd	--------EEE----EEEEEE-------HHHHHHHHHHHHHHHHH----	-13.9	-12.4	-0.04
phdpsi	--------EEEE----EEEEEHHH----HHHHHHHHHHHHHHHH-----	-8.5	-4.2	+0.03
profsec	------EEEEEE----EEEEEE------HHHHHHHHHHHHHHHH-----	-12.9	-8.0	-0.03
sspro2	------EEEEEE-HHHEEEHHH------HHHHHHHHHHHHHHHH-----	-0.7	-7.5	+0.02
prof_king	------EEEEEE-EEEEEEEEE------HHHHHHHHHHHHHHHH-----	-11.0	-5.6	0.00

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)