EVA results for 1irq:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,...
seq	IMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
dssp	---EEEEEEEHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHH-----
apssp	------EEEHHHHHEEEEEEE-------EEHHHHHHHHHHHHH-----	-3.4	+10.9	+0.09
jpred	------EEEE----EEEEEE-------HHHHHHHHHHHHHHHH-----	-9.2	-4.8	-0.00
phd	-------EEEE----EEEEEHHH----HHHHHHHHHHHHHHHH-----	-2.2	+4.2	+0.12
phdpsi	-------EEEE----EEEEEHHH----HHHHHHHHHHHHHHHH-----	-5.0	+1.9	+0.08
profsec	-----EEEEEE----EEEEEE------HHHHHHHHHHHHHHHH-----	-9.5	-4.6	0
sspro2	-----EEEEEE--HHEEEHHH------HHHHHHHHHHHHHHHH-----	+0.8	-7.5	+0.05
prof_king	-----EEEEEE--EEEEEEEE------HHHHHHHHHHHHHHHH-----	-7.6	-2.2	+0.04

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)