EVA results for 1il5:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,...
seq	IFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADV
dssp	-------EEEEE-----HHHHHHHHHHHHHHH------
apssp	---------EE--------EEEEHHH------------	-13.5	-7.8	-0.10
jpred	--------EEEEE-----HHHHHHHHHHHHHH------	+17.8	+30.9	+0.38
phd	------EEEEEE-----EHHHHHHHHHHHHHH------	+24.9	+34.6	+0.58
phdpsi	-------EEEEE-----HHHHHHHHHHHHHHH------	+25.4	+30.2	+0.68
prof_king	-------EEEEEE------HHHHHHHHHHHH------E	+11.5	+27.5	+0.31
profsec	-------EEEEE-----HHHHHHHHHHHHHHH------	+23	+27.1	+0.63
psipred	-------EEEEE-----HHHHHHHHHHHHHH-------	+20.7	+27.3	+0.50
sspro2	-------EEEEEE----HHHHHHHHHHHHHH-------	+16.9	+26.8	+0.41

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)