EVA results for 1ijw:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,..
seq	GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
dssp	-------HHHHHHHHHHHH----HHHHHHHH---HHHHHHH------
apssp	--------HHHHHHHHHHH----HHHHHHH-E--HHHHHHH------	+18.7	+30.2	+0.38
jpred	-------HHHHHHHHHHHH------EEEEEE---HHHHHHH------	+8.5	+13.2	+0.31
phd	-------HHHHHHHHHHHHH-----EEEEEE---HHH----------	+2.7	+8.3	+0.13
phdpsi	-------HHHHHHHHHHHH----HHHHHHEE---HHHH-E-------	+14.8	+27.7	+0.36
profsec	-------HHHHHHHHHHHH----HHHHHHEE---HHHEEEE------	+10.4	+20.7	+0.47
psipred	-------HHHHHHHHHHHH----HHHHHHHH---HHHHHHH------	+22.6	+26.1	+0.6
sspro2	-------HHHHHHHHHHHH----HHHHEHHH-HHHHHHH--------	+11.8	+10.7	+0.14

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)