EVA results for 1ijj:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGKDSY
dssp	---EEEEE---EEEE-E-------EEEE--EEE---------
apssp	--EEEEE-HHHHH-HHHHHHH---E-----E--------E--	-25.5	-18.9	-0.30
apssp2	---EEEE----EEEEEE-------EEEE--EEEE-------E	+8	+16.8	+0.03
jpred	--EEEEE----EEEE---------EE---EEE--------EE	+4.5	+19.6	-0.10
phd	--EEEEE----EEE------------E---EE---------E	+8.3	+19.1	-0.02
phdpsi	--EEEEE----EEEE----------EE--------------E	+4.1	+7.7	-0.08
profsec	--EEEEE----EEEE---------EE---EEEE-------EE	+4.3	+17.8	-0.08
psipred	---EEEE----EEEEEE-------EEE-----EE------EE	+3.4	+15.8	-0.11
sspro2	--EEEEE------E----------------------------	-8.2	-30.0	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)