EVA results for 1iij:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,
seq	EQRASPVTFIIATVVGVLLFLILVVVVGILIKRRR
dssp	---HHHHHHHHHHHHHHHHHHHH-----HHHHH--
apssp	--E----EEEEEEEEHHHEHHHEEEEEHHEHHE--	-28.8	-23.5	-0.13
phd	-------EEEEE--EE-EHHHEEEEEEEEEEEE--	-48.4	-44.9	-0.18
phdpsi	-------EEEEE--EE-EHHHEEEEEEEEEEEE--	-51.0	-46.4	-0.22
prof_king	------EEEEEEE--HHHHHHEEEEHHHHHHH---	-31.4	-21.1	-0.28
profsec	--------HHHHHHHHHHHHHHHEEEEEEEEEE--	-19.2	-5.1	-0.08
psipred	-------HHHHHHHHHHHHHHHHHHHHHHHHH---	-4.7	-6.5	-0.28
pssp	-------EEEEE--HH-EEEEEEEEEEEEEE----	-42.9	-39.5	-0.13
samt99_sec	------HHHHHHHHHHHHHHHHHHHHHHEEEE---	-12.9	-1.9	-0.21
sspro2	------HHHHHHHHHHHHHHHHHHHHHHHHHHH--	+0.5	-3.0	-0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)