EVA results for 1i26:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....
seq	AEKDCIAPGAPCFGTDKPCCNPRAWCSSYANKCL
dssp	-----E------------E------EE----EE-
apssp	----------------------------------	+15.0	-30.9	-0.24
phd	------------------------EE--------	+11.4	-17.3	-0.20
phdpsi	------------------------EE--------	+8.5	-19.5	-0.24
profsec	----------------------------------	+6.1	-43.6	-0.35
psipred	---------------------HHHHHHHHHH---	-17.2	-32.9	-0.37
samt99_sec	----------------------HHHHHHHH----	-10.8	-28.8	-0.34
sspro2	-----------------------HHHHHHHHH--	-11.4	-32.2	-0.33

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)