EVA results for 1i25:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,..
seq	LFECSFSCEIEKEGDKPCKKKKCKGGWKCKFNMCVKV
dssp	--E--------E----E-E-------EEE----EEE-
jpred	--EE-EE--------------------EEEEEEEE--	-6.6	-38.9	-0.28
phd	-EEEEE---------------------EEEE-EEEE-	-1.0	-24.9	-0.17
phdpsi	-EEEEE---------------------EEEE-EEEE-	-3.6	-26.4	-0.21
profsec	-EEEEEE--------------------EEEEEEEEE-	-11.4	-40.3	-0.30
psipred	-EEEEEEEEE-----------------EEEEEEEEE-	-19.3	-43.0	-0.34
pssp	--EEEEEE-HH----------------EEEEEEEEE-	-3.4	-24.0	-0.11
sspro1	--EEEEEEEEE---------------EEEEEEEEEE-	-16.4	-38.3	-0.30

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)