EVA results for 1hy9:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4.
seq	YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
dssp	-----E-------EEE----EEE--E------E------E-
apssp	-----------HHHHH------------------HHHH---	-6.0	-27.5	-0.23
jpred	-------------------EE--------------------	+1.5	-34.9	-0.30
phd	---------HHHHHHHH--EEEE-----------HHHH---	-12.8	-22.1	-0.16
phdpsi	---------HHHHHHHHH-EEEEEEE-------HHHHH---	-22.7	-25.4	-0.21
prof_king	--------------------EEEE----------HHHHHH-	-5.8	-27.3	-0.23
profsec	----------HHHHHH----E-EE--------HHHHHHH--	-20.3	-25.2	-0.28
psipred	-----------HHHHH-------HH-------HHHHHHHH-	-24.9	-28.0	-0.35
pssp	--EEEE-----HHHHH------EEE----------HHHH--	-9.3	-1.2	-0.15
samt99_sec	------------HHHH------------------HHHHH--	-15.0	-38.1	-0.33
sspro2	-------------EEE---EE--------------HHHH--	-3.7	-14.3	-0.16

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)