EVA results for 1hxs:4

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,...
seq	GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
dssp	-EEEEE------------------EEEE------HHH-------E----HHHH--E------------
apssp	----------------------EEEEEEEEE-E----------------------HHHHHHH------	-12.2	-19.8	-0.28
jpred	-----E----------E-----EEEEEEEEE-----------------------HHHHHHH-------	-11.0	-20.7	-0.24
phd	--EEEEE---------------EEEEEEEEEE-----------------------HHHHEEE------	-3.5	-6.3	-0.07
phdpsi	---EEEE---------------EEEEE-------HHHH----------------HHHHHHHHH-----	-5.4	-0.2	-0.16
prof_king	--EEEEE---------------EEEEEEEEEE--HHH------------------HHHHHHH------	-4.6	-2.2	-0.14
profsec	--EEEE----------------EEEEEEEEEEE-HHHH----------------HHHHHHHHH-----	-10.8	-10.9	-0.19
psipred	-----------EE--EEE----EEEEEEEEEEHHHHH-----------HHHHHHHHHHHHHH------	-19.3	-34.0	-0.20
sspro2	--EEEEE---------------EEEEEEEHHHHHHHHHH---------------HHHHHHHH------	-14.5	-10.9	-0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)