EVA results for 1hx2:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6
seq	NFVCPPGQTFQTCASSCPKTCETRNKLVLCDKKCNQRCGCISGTVLKSKDSSECVHPSKC
dssp	-------EEEE-------------------------EEEE----EE-------EE-----
phd	--------EEEEE-------------EEEE----------------E-------------	+1.9	-12.1	-0.23
phdpsi	-------------------------------------------EEEE------EE-----	+9.3	-3.2	-0.14
prof_king	------------------------------------------------------------	+5.6	-37.8	-0.33
profsec	-------------------------------------------EEEE-----EEE-----	+5.3	-7.0	-0.24
psipred	--------HHHHHHHH--HHH----EEEEE--------------EE--------------	-14.4	-38.6	-0.34
pssp	EEEEE---EEEEEE----------HHEEEE-----EEEEEEEEEEEE-----EEEEE---	-2.9	-7.7	-0.03
samt99_sec	--------EEE---------------------------E----EEE-------E------	+14.1	+22.7	+0.06
sspro1	-------------------------------------------EEEE-------------	+4.0	-16.5	-0.30

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)