EVA results for 1hn3:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4
seq	GSHMGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTAS
dssp	------HHHHHHHHHHH-----HHHHHHHHHH--------
apssp	------EEEEEEEHHH----HHHHHEEEEHH---------	-4.9	-1.0	+0.23
jpred	------EEEEEEEE--------EEEEEEEE----------	-26.1	-22.8	+0.23
phd	------EEEEEHHHHHHHHHHHHHHHHHHHHHH-------	+1.4	-3.7	+0.20
phdpsi	------EEEEEEE---------EEEEEEEEE---------	-26.3	-24.3	+0.26
profsec	------EEEEEEEEEE------EEEEEEEEEE--------	-28.7	-24.6	+0.49
samt99_sec	------EEEEEEEEHH-------EEEEEEEE---------	-23	-15.8	+0.27
sspro2	------EEEEEEEEE-------EEEEEEEEE---------	-28.8	-23.5	+0.28
prof_king	-----EEEEEEEEEE-------EEEEEEEEEE--------	-29.0	-21.5	+0.29

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)