EVA results for 1hll:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3..
seq	TSSIVHLCAISLDRYWSITQAIEYNLKRTPRR
dssp	-HHHHHHHHHH-HHHHHHHHHHHHH-------
apssp	--HHHEHHHHHH----EEHHHHHHH-------	-3.6	-2.1	-0.09
apssp2	---EEEEEEHHHHHHHHHH-HHHHH-------	-13.7	-20.3	-0.15
jpred	--HHHHHHHHHH-HHHHH--------------	-5.2	+0.8	-0.16
phd	--EE---E------HHHH---HHHH-------	-17.1	-22.6	-0.06
phdpsi	--EE--EEEE-E--EEEEE-------------	-49.4	-51.7	-0.22
prof_king	--HHHHHHHHHHHHHHHHH-HHHHHHH-----	+9.6	-4.5	-0.04
profsec	-HHHHHHHHHHHHHHHHH--------------	-1.6	-6.2	-0.13
psipred	--HHEEEHHHHH--HHHHHHHHHHHH------	-2.5	-5.4	-0.11
samt99_sec	--HHHHHHHHHHHHHHEEE---EE--------	-9.9	-4.2	-0.08
sspro2	--HHHHHHHHHHHHHHHHHHHHHHH-------	+16.5	+2.4	+0.22

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)