EVA results for 1h9f:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,..
seq	RQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSS
dssp	------------------HHHHH-------------HHHHHHH-HHH----------
apssp	--HH------------HHHHE-EE-------EEEEHHHHHHHHHHHHHH--------	+5.9	+13.3	+0.06
jpred	---------HHHHHHHHHHHHHHH------------HHHHHHHHHHHHH--------	+3	+9.5	+0.04
phd	--------------HHHHHHHHHHH-------EE--HHHHHHHHHHHHH--------	+9.3	+5.1	+0.19
phdpsi	--------------HHHHHHHHHHH-------EE--HHHHHHHHHHHHH--------	+6.7	+3.6	+0.15
prof_king	---------EEE--HHHHHHHHHH-------------HHHHHHHHHHHH--------	+4.5	-4.5	+0.02
profsec	--------------HHHHHHHHHHH-----------HHHHHHHHHHHHH--------	+7.8	+16.3	+0.12
psipred	---------HHHH-HHHHHHHHHH------------HHHHHHHHHHHHHHHHH----	-4.2	-16.5	-0.04
pssp	---------HHHH---HHHHHHEEEE-----EEE-HHHHHHHHHHHHHH--------	+7.2	-6.0	+0.16
samt99_sec	---------HHHH-HHHHHHHHHHH----------HHHHHHHHHHHHHHHHH-----	-5.6	-14.5	-0.03
sspro2	-----------E---HHHHHHHHHH-----------HHHHHHHHHHHHHH-------	+5.9	+0.1	+0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)