EVA results for 1h9e:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,.
seq	PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGT
dssp	-------------HHHHHHHH-------------HHHHHHHHH-------------
apssp	-------HH-HH-----HHHE--EE----------EHHEEHH--------------	+5.4	-3.4	-0.03
jpred	----------HHHHHHHHHHH-----------HHHHHHHHHHHHHH----------	+11.5	+30.1	+0.18
phd	-------HHH-----EEEEEE----------HHHHHHHHHHHH-------------	+3.6	+4.5	+0.15
phdpsi	-------HHH-----EEEEEE----------HHHHHHHHHHHH-------------	+1.0	+3.0	+0.11
prof_king	-----------HHHHHHHHHH-----------HHHHHHHHHHHHHH----------	+13.1	+29.8	+0.21
profsec	-------HHH-HHHHHHHH------------HHHHHHHHHHHH-------------	+5.7	+6.0	-0.01
psipred	------HHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHH----------	-4.7	+8.5	-0.04
pssp	------------HHHHHHHHH--EE------HHHHHH--EEHHHH-----------	+15.6	+11.5	+0.13
samt99_sec	-----------HHHHHHHHHH---E------HHHHEHHHHHHHHHH----------	+6.2	+2.2	+0.12
sspro2	--------H--HHHHHHHHHH-------HHHHHHHHHHHHHHHHHH----------	+2	+6.4	+0.06

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)