EVA results for 1h7d:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....
seq	MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQGPTCS
dssp	---------------------------HHHHH-----------------
apssp	-HHHHHHHH-----------HHH-HHHHHEEEEE----EEEE-------	-14.2	-29.6	-0.06
jpred	-HHHHHHHH---------HHHHHHHHHHEEEEE------EEE-------	-24.9	-32.5	-0.05
phd	-HHHHHHHHH-HHHHHHHHHHHH-----EEEE-------EE--------	-27.9	-42	+0.08
phdpsi	-HHHHHHHHH-HHHHHHHHHHHH-----EEEE-------EE--------	-30.8	-44.2	+0.04
prof_king	HHHHHHHHHH----------HHHHHHEEEEEEEE----EEEE-------	-31.3	-22.1	-0.00
profsec	-HHHHHHHH---HHHHHHHHHH------EEEE-------EE--------	-27.2	-43.4	-0.02
psipred	-HHHHHHHHH--------HHHHHHHHHHHHHHHH-----EEE-------	-23.0	-37.4	-0.22
samt99_sec	-HHHHHHHHH---------HHHHHHHHHHHHEE------EE--------	-18.5	-30.8	-0.19
sspro2	-HHHHHHHH----E-----HHHHHHHHHHHHHE------EEE-------	-19.0	-41	-0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)