EVA results for 1h0z:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,...
seq	ESGKATSYAELCNEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGESRN
dssp	-------HHHHHHHH------------------E-----E---HHHHHHHHHHHHHHH----------
jufo	------HHHHHHHHHHHHHH--------------------------HHHHHHHHHHHHH---------	+12.6	+12.2	+0.10
phd	-------------HHH----------------EEE---------HHHHHHH--HHHHHHHH-------	+5.4	+3.2	-0.04
phdpsi	-------------HHH----------------EEE---------HHHHHHH--HHHHHHHH-------	+3.8	+1.7	-0.06
prof_king	-------HHHHHHHHHHHHH--------------------------HHHHHHHH--HHHHHH------	+3.5	-4.8	-0.07
profsec	------------HHHHHH--------------------------HHHHHHHHHHHHHHHHHHH-----	+1.5	+0.2	-0.12
prospect	-------------------------------------------HHHHHHHHH-----EEEEE------	-1.1	-15.0	-0.07
psipred	-----HHHHHHHHHHHHHH---EEEEEE---------------HHHHHHHHHH--HHHHHH-------	-3.3	-15.3	-0.04
samt99_sec	--------------------------------EE---------HHHHHHHHHHH---EEEE-------	+0.3	-0.5	-0.03
scratch	-------HHHHHHHHHHHHH---EEE------------------HHHHHHHHHHHHHHHHHH------	+3.0	-7.7	+0.04

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)