EVA results for 1gj6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....
seq	IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQW
dssp	-E--EE--------EEEEE---EEEEEEEEE--E
apssp	-E---E--------EEEEE---EEEEEEEEE--E	+20.9	+25.8	+0.44
apssp2	-E--EE--------EEEEE---EEEEEEEEE--E	+16.8	+21.0	+0.47
jpred	-------------EEEEEE---EE---EEE---E	+2.4	-11.6	-0.06
phd	--------------EEEEE---------EEEE-E	0.0	-7.0	-0.07
phdpsi	-------------EEEEEE--------EEEEE-E	-3.9	-9.0	-0.16
profsec	-------------EEEEEE---EEE-EEEEE--E	+8.6	-5.8	+0.05
psipred	----EE--------EEEEE---EEEEEEEEE--E	+19.3	+19.0	+0.42
sspro2	----EE-------EEEEEE---EEE-EEEE---E	+10.9	+3.5	+0.10
prof_king	-------------EEEEEE---EEEEEEEE---E	+10.6	+8.4	+0.08

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)