EVA results for 1ggx:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,
seq	VIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDILSPQFSKVYVK
dssp	-----EEEEEEEEEEE--EEEEEEEEEEEE----EEEEEEEEEE-------HHH-HHH--HHH-E
phd	-HHHHEEEEEEEEEE-----EEEE------------EEEEEE---------HHHHHH---HHHHH	-3.6	+2.1	+0.14
phdpsi	-----EEEEEEEEEE----EEEEEE-----------EEEEEEE-------HHHHHHHHHHHHHHH	+1.4	+5.5	+0.20
psipred	-----EEEEEEEEEEE--EEEEEEEEE-------EEEEEEEEEE--------------HHHHHH-	+3.8	+6.0	+0.18
pssp	--HHHHHH-HHHH------EEEE-------------EEEEEE------EEE--------EEEEEE	-24.4	-15.7	-0.13
samt99_sec	HH---EEEEEEEEEE----EEEEE-----------EEEEEEEE----------HEEE--	-6.3	+4.3	-0.06
sspro1	------EEEEEEE-----EEEEEE-----------EEEEEEEE---------------HHHHE--	-9.7	-2.0	-0.04

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)