EVA results for 1gc2:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....
seq	LPGFATRAIHHGYDPQDHGGALVPPVYQTATFTFPTVEISNPTL
dssp	---HHHHHHH----HHH---E----E-----E---------HHH
apssp	----HHHHHH---------------EEEEEEEE---------HH	-3.9	-12.2	-0.01
apssp2	---HHHHHH----------------EE---------------HH	-1.7	-18.1	-0.11
jpred	-----HHHH----------------EEE--------------HH	+1	-11.5	-0.02
phd	------EEEE---------------EEEEEEEEE---------H	-16.1	-29.7	-0.20
phdpsi	------EE-E---------------EEEEEEEEEEE-------H	-24.2	-38.7	-0.26
prof_king	-----EEEEE--------------EEEEE-EEEEE--------H	-22.3	-32.0	-0.27
profsec	-----EEEEE---------------EEEEEEEEEEE-------H	-26.6	-40.8	-0.31
psipred	---HHHHHHH---------------EEE--EEE---------HH	+1.5	-7.3	+0.04
sspro2	-----EEEEE---------------EEEEEEEEEE-------HH	-22.4	-31.9	-0.27

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)