EVA results for 1gc2:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4
seq	LPGFATRAIHHGYDPQDHGGALVPPVYQTATFTFSNPTLN
dssp	---HHHHHHH----HHHH--E----E-----E----HHHH
apssp	----HHHHHHH----------EE--EE---EEE----HHH	-9.1	-1.3	-0.09
apssp2	---HHHHHH------------E----E--EEEE-----HH	-18.5	-14.1	-0.22
jpred	-------------------------EEE----------HH	-16.5	-43.1	-0.17
phd	-----EEEEE----------------EEEEEEE-----HH	-23.1	-36.0	-0.20
phdpsi	-------EE----------------EEEEEE-------HH	-24.2	-40.7	-0.25
prof_king	------EEEE--------------EEEE---EE-----HH	-19.6	-29.0	-0.23
profsec	-----EEEEE-----------EE--EEEEEEEE-----HH	-31.6	-36.1	-0.29
psipred	---HHHHHHH---------------EE----EE-----HH	-0.4	-9.9	+0.01
sspro2	-----EHEEE---------------EEEEEEE------HH	-21.9	-36.4	-0.25

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)