EVA results for 1gc0:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....
seq	LPGFATRAIHHGYDPQDHGGALVPPVYQTATFTFPTVESNPTLN
dssp	---HHHHHHH----HHHH--E----E-----E--------HHHH
apssp	----HHHHHH-----------EE-EEE--------------HHH	-3.9	-10.7	-0.03
apssp2	---HHHHHH-----------------E--EEEE---------HH	-13.0	-17.0	-0.21
jpred	-----HHHHH---------------E----------------HH	+3.3	-12.0	+0.05
phd	-----EEEEE---------------EEEEEEEEE--------HH	-18.3	-27.5	-0.18
phdpsi	------EE-----------------EEEEEEEEEE-------HH	-24.2	-36.3	-0.22
prof_king	-----EEEEE--------------EEEEEEEEEE--------HH	-24.6	-31.6	-0.25
profsec	-----EEEEE-----------EE--EEEEEEEEE--------HH	-28.9	-28.9	-0.29
psipred	---HHHHHHH---------------EE--EEEE--------HHH	-0.6	-8	+0.02
sspro2	-----EEEEE---------------EEEEEEEEE--------HH	-24.6	-33.0	-0.29

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)