EVA results for 1g5v:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,.
seq	QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPI
dssp	-------EEEEE------EEEEEEEEEE----EEEEEE-----EEEEEHHH-E---
apssp	-------EEEEEE---------EEEE------EEEEEEEE----------------	+1.9	+9.5	-0.02
jpred	--------EEEEE------EEEEEEEE-----EEEEEEE-----EEEE--------	+7.8	+19.8	+0.09
phd	--EE----EEEEE-----EEEEEEEEE-----EEEEEE-----HHH--HHHH----	+7.2	+11.4	+0.13
phdpsi	--EEE--EEEEEE-----EEEEEHHHH-----EEEEEEEE-----E----------	-7.8	-5.1	-0.05
prof_king	---EE--EEEEEEE----EEEEEEEEE-----EEEEEEEE-----EE--H------	+2.4	+6.7	-0.01
profsec	--EEE--EEEEEEE----EEEEEEEEE-----EEEEEEEE----EEEEE-------	+0.4	+3.9	-0.07
psipred	-------EEEEEEEE--EEEEEEEEEE-----EEEEEE-------EEEHHHH----	+7.7	+16.5	+0.12
pssp	---EE---EEEEEE--------HHH-----EEEEEEEEE---------HHHH----	-7.5	-5.9	-0.01
samt99_sec	--------EEEEE-----EEEEEEEEE------EEEEEEE----EEE-HHHHHH--	+4.5	+20.8	+0.07
sspro2	----E---EEEEE-----EEEEEEEEEE-----EEEEEE------H--HHH-----	+3.8	+8.9	+0.08

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)