EVA results for 1g2c:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4
seq	PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAG
dssp	-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------
jpred	---------HHHHHHHHHHHHHHHHHHHHHHHHHHH----	+10.8	+28.4	+0.01
phd	------HHHHHHHHHHHHHHHHHHHHHH-HHHHHHH----	+18.6	+1.8	+0.21
phdpsi	------HHHHHHHHHHHHHHHHHHHHHH-HHHHHHH----	+16.0	+0.3	+0.17
prof_king	--------HHHHHHHHHHHHHHHHHHHH--HHHHHH----	+8.1	-2.4	-0.03
profsec	------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---	+13.6	+22.7	+0.12
psipred	-------HH-HHHHHHHHHHHHHHHHHHHHHHHH------	+16.3	-9.3	+0.29
pssp	--EE-----HHHHHHHHHHHHHHHHHHHHHHHHH------	+22.0	+29.5	+0.39
sspro1	------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----	+19.0	+29.6	+0.32

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)